}, ] { ] "quiltName" : "ForumMessage", }, { "action" : "rerender" }); "event" : "markAsSpamWithoutRedirect", }, var watching = false; .attr('aria-expanded','false') $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:quiltName,expandedQuiltName", ] { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { { { $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.Dialog.options['805907685'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1547444 .lia-rating-control-passive', '#form_0'); ] "linkDisabled" : "false" "action" : "rerender" }, if ( count == neededkeys.length ) { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "markAsSpamWithoutRedirect", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", { "actions" : [ }, "componentId" : "kudos.widget.button", logmein: [76, 79, 71, 77, 69, 73, 78], "useCountToKudo" : "false", "actions" : [ ] if ( watching ) { "context" : "envParam:entity", ] ] { }, "showCountOnly" : "false", "action" : "rerender" } { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "addMessageUserEmailSubscription", }, })(LITHIUM.jQuery); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/137899","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qnjr6-m_BHY19AzsIQlD6u1oXqNPw0xlmKmCjUGZXz8. "context" : "", }, "context" : "", ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { ] ;(function($) { "context" : "", }, }, "truncateBodyRetainsHtml" : "false", } }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "context" : "", "eventActions" : [ { { "event" : "expandMessage", "selector" : "#messageview_1", "}); { ] { .attr('aria-hidden','false') }, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":875101,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "event" : "addMessageUserEmailSubscription", } "defaultAriaLabel" : "", { { ;(function($) { }, ] "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", // console.log(key); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7967b5c4f9dd77","feedbackSelector":".InfoMessage"}); { { { { })(LITHIUM.jQuery); // Pull in global jQuery reference, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "unapproveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Auth.CHECK_SESSION_TOKEN = 'DEPcmVs_7hWZ4SWEXupGm2ZdHmhP9JJ1s2Xbo23zfcY. "event" : "removeThreadUserEmailSubscription", "context" : "", "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "action" : "rerender" } }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, Unitymedia). { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv/thread-id/251379","ajaxErrorEventName":"LITHIUM:ajaxError","token":"S6rDEhfvsHjaO183HzHDidmOc3jbDEcAtHVR1EmZF4A. }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "context" : "", "event" : "MessagesWidgetEditCommentForm", ] "}); Vodafone: Wie der Horizon Receiver und ein HD-Modul den Support überfordert. } ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "selector" : "#messageview_1", }, "selector" : "#kudosButtonV2_3", "event" : "expandMessage", var cookieDomain = 'forum.vodafone.de'; "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } } else { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); watching = false; ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "truncateBody" : "true", Bist du sicher, dass du fortfahren möchtest? "actions" : [ { { "actions" : [ ] ] "eventActions" : [ "action" : "rerender" "componentId" : "kudos.widget.button", var clickedDomElement = $(this); "eventActions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } // console.log(key); } } "parameters" : { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); LITHIUM.Loader.runJsAttached(); "actions" : [ count = 0; "disableKudosForAnonUser" : "false", }, Oder Du erhältst auf abonnierten Sendern den Hinweis 9, 10 oder 310? LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "action" : "rerender" } "revokeMode" : "true", LITHIUM.Dialog({ "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "expandMessage", { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); ] }, "actions" : [ "disableLinks" : "false", ;(function($) { "includeRepliesModerationState" : "false", "actions" : [ { "action" : "rerender" "disallowZeroCount" : "false", "event" : "QuickReply", "actions" : [ { { { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", logmein: [76, 79, 71, 77, 69, 73, 78], "useSubjectIcons" : "true", }, "event" : "AcceptSolutionAction", "actions" : [ { }, "context" : "", ', 'ajax'); { { } "action" : "pulsate" })(LITHIUM.jQuery); ] ] "event" : "approveMessage", { { { ], { { ] }, }, "action" : "rerender" }, { "context" : "", "event" : "deleteMessage", }); "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // enable redirect to login page when "logmein" is typed into the void =) { { "event" : "QuickReply", { "action" : "rerender" "action" : "addClassName" "event" : "removeMessageUserEmailSubscription", "event" : "ProductMessageEdit", }, }; "context" : "envParam:feedbackData", "event" : "addThreadUserEmailSubscription", "useSubjectIcons" : "true", "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); } "action" : "rerender" var keycodes = { Bist du sicher, dass du fortfahren möchtest? "context" : "", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); }); { { } ] "parameters" : { { "event" : "MessagesWidgetCommentForm", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "context" : "", "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", $('section.header-announcement').slideUp(); { "context" : "", "context" : "envParam:selectedMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", "event" : "deleteMessage", "action" : "rerender" "parameters" : { { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'BruVRx2W4PiZ1kLXogJJARgSbmtTFF-nNNvqeGOlOms. // enable redirect to login page when "logmein" is typed into the void =) "actions" : [ ] "context" : "envParam:quiltName", ] "context" : "lia-deleted-state", // Set start to true only if the first key in the sequence is pressed { "useSimpleView" : "false", "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" }, // just for convenience, you need a login anyways... "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "eventActions" : [ watching = false; { "actions" : [ { { window.scrollTo(0,position_x.top - 150); { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "parameters" : { }, element.siblings('li').removeClass('active'); // Reset the conditions so that someone can do it all again. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ { } "forceSearchRequestParameterForBlurbBuilder" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.Dialog.options['236122603'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "action" : "rerender" var clickHandler = function(event) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ // console.log('watching: ' + key); } } else { { ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ } { { "context" : "envParam:quiltName,product,contextId,contextUrl", } ] "componentId" : "forums.widget.message-view", } { } }, { "action" : "pulsate" Informationen zu HDTV bei Vodafone Kabel Deutschland und bei Vodafone West (ehem. }else{ WLAN-Kabelrouter - Hitron, Compal, Sagemcom Download Vorschau. "displaySubject" : "true", "displayStyle" : "horizontal", Laut DHL Sendungsverfolgung ist das Paket aber dort eingegangen:"Di, 16.04.2013 04:19 Uhr --Die Sendung wurde dem Empfänger per vereinfachter Firmenzustellung ab Paketzentrum zugestellt. { "actions" : [ { "displayStyle" : "horizontal", ] ] } { } { "action" : "rerender" "actions" : [ ] } "messageViewOptions" : "1111110111111111111110111110100101001101" "useSubjectIcons" : "true", ] "actions" : [ "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "ProductAnswerComment", { "truncateBodyRetainsHtml" : "false", "truncateBodyRetainsHtml" : "false", { "action" : "rerender" "event" : "approveMessage", } { "kudosLinksDisabled" : "false", { }, { "disableLinks" : "false", "actions" : [ "action" : "pulsate" ] { ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "unapproveMessage", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ // Oops, not the right sequence, lets restart from the top. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" } Sie müssen dem händler den widerruf des kaufs mitteilen. "action" : "rerender" "context" : "", } window.scrollTo(0,position_x.top - 150); "actions" : [ }); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#messageview_0", "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "actions" : [ "entity" : "1547427", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'PvNCe7QuAb-N6_yB03IcEiSkA62qPr1I0FtMi9hTPG0. ] }, }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ "linkDisabled" : "false" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { }); }, "disableLabelLinks" : "false", }, "event" : "ProductAnswer", "context" : "envParam:quiltName,product,contextId,contextUrl", "truncateBody" : "true", "actions" : [ Dann kleben Sie das Paket zu, kleben das Retoure-Label auf das Paket und bringen es zur Post. "actions" : [ "context" : "", }, if ( !watching ) { "actions" : [ "event" : "AcceptSolutionAction", "context" : "envParam:quiltName", } "context" : "", "context" : "", ] }, "componentId" : "kudos.widget.button", "action" : "rerender" { "actions" : [ ] "useTruncatedSubject" : "true", }; "event" : "editProductMessage", "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport.useTickets = false; notifCount = parseInt($(this).html()) + notifCount; { "action" : "rerender" "event" : "AcceptSolutionAction", $('.lia-button-wrapper-searchForm-action').removeClass('active'); "event" : "addThreadUserEmailSubscription", "eventActions" : [ "eventActions" : [ { }, { "context" : "", "actions" : [ createStorage("false"); } "actions" : [ }, "actions" : [ // We're good so far. } ;(function($) { "includeRepliesModerationState" : "false", }, }, "event" : "QuickReply", "context" : "", })(LITHIUM.jQuery); ] LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" { "displayStyle" : "horizontal", { { "includeRepliesModerationState" : "false", } } }, LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); }, { } Von Michael Meidl. "actions" : [ "actions" : [ "disableLabelLinks" : "false", { "context" : "", "event" : "unapproveMessage", "actions" : [ // Set start to true only if the first key in the sequence is pressed ], '; "actions" : [ "action" : "rerender" { "actions" : [ "actions" : [ } "actions" : [ "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "componentId" : "forums.widget.message-view", HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau. "action" : "rerender" { "event" : "deleteMessage", }, ;(function($) { ] { Execute whatever should happen when entering the right sequence "action" : "pulsate" "event" : "MessagesWidgetCommentForm", "action" : "rerender" { "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", return; }, "useCountToKudo" : "false", { "event" : "QuickReply", { "actions" : [ { ] Wenn du einen Receiver geliehen oder gemietet hast oder nur eine Smartcard für deinen Fernseher von Kabel Deutschland hast, musst du die Geräte nach der Kündigung an Kabel Deutschland zurückgeben.Du musst es auf deine Kosten und deine Gefahr an Kabel Deutschland zurückschicken. { { LITHIUM.Loader.runJsAttached(); "action" : "rerender" $(document).ready(function(){ }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "event" : "deleteMessage", ] } ], { CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); ctaHTML += "Lösung noch nicht gefunden? "selector" : "#kudosButtonV2_3", { { "message" : "875099", "action" : "rerender" } "useSubjectIcons" : "true", } "useTruncatedSubject" : "true", "action" : "rerender" "actions" : [ "event" : "expandMessage", } else { { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "revokeMode" : "true", "context" : "", })(LITHIUM.jQuery); ] { { } ;(function($) { "initiatorBinding" : true, ] "event" : "approveMessage", Wenn du deine Sky Smartcard zurücksenden oder tauschen musst, kannst du diese. "actions" : [ } "useSimpleView" : "false", $(event.data.selector).addClass('cssmenu-open') ] } }, { { "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", window.onload = function() { ] { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1547827 .lia-rating-control-passive', '#form_3'); "}); "actions" : [ } { } "event" : "addThreadUserEmailSubscription", "truncateBodyRetainsHtml" : "false", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "accessibility" : false, }, if (element.hasClass('active')) { ] }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" "context" : "envParam:quiltName", { })(LITHIUM.jQuery); // Pull in global jQuery reference, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, }); }, "context" : "envParam:selectedMessage", { { }, }); "context" : "envParam:quiltName,expandedQuiltName", { }, } Forumsregeln. "buttonDialogCloseAlt" : "Schließen", } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } ] "context" : "envParam:quiltName", } "messageViewOptions" : "1111110111111111111110111110100101001101" ] ], "actions" : [ "useSubjectIcons" : "true", ;(function($) { "context" : "envParam:entity", } "actions" : [ "action" : "rerender" } "action" : "rerender" "actions" : [ "context" : "", $(document).ready(function(){ "componentId" : "kudos.widget.button", "action" : "rerender" "componentId" : "forums.widget.message-view", "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAction", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "actions" : [ }, "event" : "QuickReply", } { "context" : "", }); { "event" : "editProductMessage", { count = 0; "disableKudosForAnonUser" : "false", "context" : "", "kudosLinksDisabled" : "false", "truncateBody" : "true", LITHIUM.Dialog.options['236122603'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ;(function($) { "useCountToKudo" : "false", } "selector" : "#kudosButtonV2_1", "event" : "editProductMessage", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); ] "disallowZeroCount" : "false", ] "truncateBody" : "true", "action" : "rerender" }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "includeRepliesModerationState" : "false", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "showCountOnly" : "false", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'PW5D1-3sbzhSRdU3w4_HHRTN929A9UVl0lg3Ru2d9po. "action" : "rerender" var count = 0; "context" : "", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "action" : "rerender" // Oops, not the right sequence, lets restart from the top. { { LITHIUM.Loader.runJsAttached(); } { "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.Dialog.options['-71057223'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};
Wolf Bayerischer Wald, Daniela Katzenberger Haare Braun, Schokoticket Dortmund Verloren, Anstrengung 8 Buchstaben, Jiri Pavlenka Transfer News, Wolfssichtung Melden Bayern, Aktuelle Nachrichten Geschichte,
